SCOPe 2.06: Domain d1t57b_: 1t57 B:

Lineage for d1t57b_ (1t57 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families)

5. Family c.49.1.2: MTH1675-like [110616] (2 proteins)
   PfamB PB019040; probable flavoenzyme, binds FMN; the phosphoribityl group binds in the equivalent site to the binding site of the PK allosteric regulator FBP

6. Protein Hypothetical protein MTH1675 [110617] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [110618] (1 PDB entry)
   Uniprot O27711

8. Domain d1t57b_: 1t57 B: [106431]
   Structural genomics target
   complexed with fmn, mg

Details for d1t57b_

PDB Entry: 1t57, 2.3 Å

PDB Description: crystal structure of the conserved protein mth1675 from methanobacterium thermoautotrophicum

PDB Compounds: (B:) Conserved Protein MTH1675

SCOPe Domain Sequences for d1t57b_:

Sequence; same for both SEQRES and ATOM records:

>d1t57b_ c.49.1.2 (B:) Hypothetical protein MTH1675 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mekkicyfeepgkentervlelvgeradqlgirnfvvasvsgetalrlsemvegnivsvt
hhagfrekgqleledeardallergvnvyagshalsgvgrgisnrfggvtpveimaetlr
mvsqgfkvcveiaimaadaglipvdeeviaiggtawgadtalvltpahmnsvfdlrihev
iamprp

Timeline for d1t57b_:

• d1t57b_ first appeared in SCOP 1.69
  
• d1t57b_ appears in SCOPe 2.05
  
• d1t57b_ appears in SCOPe 2.07
  
• d1t57b_ appears in the current release, SCOPe 2.08