![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
![]() | Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) ![]() |
![]() | Family c.49.1.2: MTH1675-like [110616] (2 proteins) PfamB PB019040; probable flavoenzyme, binds FMN; the phosphoribityl group binds in the equivalent site to the binding site of the PK allosteric regulator FBP |
![]() | Protein Hypothetical protein MTH1675 [110617] (1 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [110618] (1 PDB entry) Uniprot O27711 |
![]() | Domain d1t57b_: 1t57 B: [106431] Structural genomics target |
PDB Entry: 1t57 (more details), 2.3 Å
SCOP Domain Sequences for d1t57b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t57b_ c.49.1.2 (B:) Hypothetical protein MTH1675 {Methanobacterium thermoautotrophicum [TaxId: 145262]} mekkicyfeepgkentervlelvgeradqlgirnfvvasvsgetalrlsemvegnivsvt hhagfrekgqleledeardallergvnvyagshalsgvgrgisnrfggvtpveimaetlr mvsqgfkvcveiaimaadaglipvdeeviaiggtawgadtalvltpahmnsvfdlrihev iamprp
Timeline for d1t57b_: