SCOP 1.69: Domain d1t56a1: 1t56 A:22-94

Lineage for d1t56a1 (1t56 A:22-94)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins)

6. Protein Ethr repressor [109651] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109652] (1 PDB entry)

8. Domain d1t56a1: 1t56 A:22-94 [106428]
   Other proteins in same PDB: d1t56a2

Details for d1t56a1

PDB Entry: 1t56, 1.7 Å

PDB Description: Crystal structure of TetR family repressor M. tuberculosis EthR

SCOP Domain Sequences for d1t56a1:

Sequence; same for both SEQRES and ATOM records:

>d1t56a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

Timeline for d1t56a1:

• d1t56a1 is new in SCOP 1.69
  
• d1t56a1 appears in SCOP 1.71
  
• d1t56a1 appears in the current release, SCOPe 2.08