![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
![]() | Protein Transcription factor CEP-1 [110078] (1 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110079] (1 PDB entry) Uniprot Q20646 223-418 |
![]() | Domain d1t4wa_: 1t4w A: [106427] complexed with zn |
PDB Entry: 1t4w (more details), 2.1 Å
SCOPe Domain Sequences for d1t4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t4wa_ b.2.5.2 (A:) Transcription factor CEP-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ekwmeidvlkqkvakssdmafaissehekylwtkmgclvpiqvkwkldkrhfnsnlslri rfvkydkkenveyairnprsdvmkcrshtereqhfpfdsffyirnsehefsysaekgstf tlimypgavqanfdiifmcqekcldlddrrktmclavflddengneilhayikqvrivay prrdwknfceredakq
Timeline for d1t4wa_: