Lineage for d1t4ob_ (1t4o B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904269Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1904270Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 1904271Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 1904298Protein RNase III, C-terminal domain [54776] (3 species)
  7. 1904319Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110913] (3 PDB entries)
    Uniprot Q02555 364-447 ! Uniprot Q02555 366-453 ! Uniprot Q02555 363-443
  8. 1904321Domain d1t4ob_: 1t4o B: [106426]

Details for d1t4ob_

PDB Entry: 1t4o (more details), 2.5 Å

PDB Description: Crystal structure of rnt1p dsRBD
PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1t4ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4ob_ d.50.1.1 (B:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mktdkldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrni
kiagiraaenalrdkkmldfyakqraai

SCOPe Domain Coordinates for d1t4ob_:

Click to download the PDB-style file with coordinates for d1t4ob_.
(The format of our PDB-style files is described here.)

Timeline for d1t4ob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t4oa_