SCOPe 2.04: Domain d1t4ob_: 1t4o B:

Lineage for d1t4ob_ (1t4o B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
   Pfam PF00035

6. Protein RNase III, C-terminal domain [54776] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110913] (3 PDB entries)
   Uniprot Q02555 364-447 ! Uniprot Q02555 366-453 ! Uniprot Q02555 363-443

8. Domain d1t4ob_: 1t4o B: [106426]

Details for d1t4ob_

PDB Entry: 1t4o, 2.5 Å

PDB Description: Crystal structure of rnt1p dsRBD

PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1t4ob_:

Sequence; same for both SEQRES and ATOM records:

>d1t4ob_ d.50.1.1 (B:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mktdkldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrni
kiagiraaenalrdkkmldfyakqraai

Timeline for d1t4ob_:

• d1t4ob_ first appeared in SCOP 1.69
  
• d1t4ob_ appears in SCOPe 2.03
  
• d1t4ob_ appears in SCOPe 2.05
  
• d1t4ob_ appears in the current release, SCOPe 2.08