SCOP 1.73: Domain d1t4oa_: 1t4o A:

Lineage for d1t4oa_ (1t4o A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
   Pfam PF00035

6. Protein RNase III, C-terminal domain [54776] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110913] (3 PDB entries)

8. Domain d1t4oa_: 1t4o A: [106425]

Details for d1t4oa_

PDB Entry: 1t4o, 2.5 Å

PDB Description: Crystal structure of rnt1p dsRBD

PDB Compounds: (A:) Ribonuclease III

SCOP Domain Sequences for d1t4oa_:

Sequence; same for both SEQRES and ATOM records:

>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdkldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrniki
agiraaenalrdkkmldfyak

Timeline for d1t4oa_:

• d1t4oa_ first appeared in SCOP 1.69
  
• d1t4oa_ appears in SCOP 1.71
  
• d1t4oa_ appears in SCOP 1.75
  
• d1t4oa_ appears in the current release, SCOPe 2.08