Lineage for d1t4oa_ (1t4o A:)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.50: dsRBD-like [54767] (4 superfamilies)
alpha-beta(3)-alpha; 2 layers: alpha/beta
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) 
Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (5 proteins) 
Protein RNase III, C-terminal domain [54776] (3 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110913] (3 PDB entries) 
Domain d1t4oa_: 1t4o A: [106425]
Details for d1t4oa_
PDB Entry: 1t4o (more details), 2.5 Å
PDB Description: Crystal structure of rnt1p dsRBD
SCOP Domain Sequences for d1t4oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
tdkldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrniki
agiraaenalrdkkmldfyak
SCOP Domain Coordinates for d1t4oa_:
Click to download the PDB-style file with coordinates for d1t4oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t4oa_:
- d1t4oa_ is new in SCOP 1.69
- d1t4oa_ appears in SCOP 1.71
- d1t4oa_ appears in the current release, SCOPe 2.08
View in 3D
