Lineage for d1t4na_ (1t4n A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722459Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 722460Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
    Pfam PF00035
  6. 722486Protein RNase III, C-terminal domain [54776] (3 species)
  7. 722501Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110913] (3 PDB entries)
  8. 722505Domain d1t4na_: 1t4n A: [106424]

Details for d1t4na_

PDB Entry: 1t4n (more details)

PDB Description: Solution structure of Rnt1p dsRBD
PDB Compounds: (A:) Ribonuclease III

SCOP Domain Sequences for d1t4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4na_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdkldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrniki
agiraaenalrdkkmldfyakqraaalg

SCOP Domain Coordinates for d1t4na_:

Click to download the PDB-style file with coordinates for d1t4na_.
(The format of our PDB-style files is described here.)

Timeline for d1t4na_: