Lineage for d1t4na1 (1t4n A:363-447)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946868Protein RNase III, C-terminal domain [54776] (3 species)
  7. 2946889Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110913] (3 PDB entries)
    Uniprot Q02555 364-447 ! Uniprot Q02555 366-453 ! Uniprot Q02555 363-443
  8. 2946892Domain d1t4na1: 1t4n A:363-447 [106424]
    Other proteins in same PDB: d1t4na2

Details for d1t4na1

PDB Entry: 1t4n (more details)

PDB Description: solution structure of rnt1p dsrbd
PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d1t4na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4na1 d.50.1.1 (A:363-447) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdkldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrniki
agiraaenalrdkkmldfyakqraa

SCOPe Domain Coordinates for d1t4na1:

Click to download the PDB-style file with coordinates for d1t4na1.
(The format of our PDB-style files is described here.)

Timeline for d1t4na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t4na2