![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
![]() | Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins) Pfam PF00035 |
![]() | Protein RNase III, C-terminal domain [54776] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110913] (3 PDB entries) Uniprot Q02555 364-447 ! Uniprot Q02555 366-453 ! Uniprot Q02555 363-443 |
![]() | Domain d1t4lb_: 1t4l B: [106423] protein/RNA complex |
PDB Entry: 1t4l (more details)
SCOPe Domain Sequences for d1t4lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t4lb_ d.50.1.1 (B:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gsldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikia giraaenalrdkkmldfyakqraaiprses
Timeline for d1t4lb_: