SCOP 1.69: Domain d1t4lb_: 1t4l B:

Lineage for d1t4lb_ (1t4l B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.50: dsRBD-like [54767] (4 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (5 proteins)

6. Protein RNase III, C-terminal domain [54776] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110913] (3 PDB entries)

8. Domain d1t4lb_: 1t4l B: [106423]

Details for d1t4lb_

PDB Entry: 1t4l

PDB Description: solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with the 5' terminal rna hairpin of snr47 precursor

SCOP Domain Sequences for d1t4lb_:

Sequence; same for both SEQRES and ATOM records:

>d1t4lb_ d.50.1.1 (B:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
gsldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikia
giraaenalrdkkmldfyakqraaiprses

Timeline for d1t4lb_:

• d1t4lb_ is new in SCOP 1.69
  
• d1t4lb_ appears in SCOP 1.71
  
• d1t4lb_ appears in the current release, SCOPe 2.08, called d1t4lb1