Lineage for d1t4lb_ (1t4l B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503301Fold d.50: dsRBD-like [54767] (4 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 503302Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 503303Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (5 proteins)
  6. 503312Protein RNase III, C-terminal domain [54776] (3 species)
  7. 503315Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110913] (3 PDB entries)
  8. 503318Domain d1t4lb_: 1t4l B: [106423]

Details for d1t4lb_

PDB Entry: 1t4l (more details)

PDB Description: Solution structure of double-stranded RNA binding domain of S. cerevisiae RNase III (Rnt1p) in complex with the 5' terminal RNA hairpin of snR47 precursor

SCOP Domain Sequences for d1t4lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4lb_ d.50.1.1 (B:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
gsldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikia
giraaenalrdkkmldfyakqraaiprses

SCOP Domain Coordinates for d1t4lb_:

Click to download the PDB-style file with coordinates for d1t4lb_.
(The format of our PDB-style files is described here.)

Timeline for d1t4lb_: