SCOP 1.73: Domain d1t4ha_: 1t4h A:

Lineage for d1t4ha_ (1t4h A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase wnk1 [111196] (1 species)
   OPK group; WNK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [111197] (1 PDB entry)

8. Domain d1t4ha_: 1t4h A: [106420]

Details for d1t4ha_

PDB Entry: 1t4h, 1.8 Å

PDB Description: Crystal structure of the kinase domain of WNK1, a kinase that causes a hereditary form of hypertension

PDB Compounds: (A:) Serine/threonine-protein kinase WNK1

SCOP Domain Sequences for d1t4ha_:

Sequence; same for both SEQRES and ATOM records:

>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}
avgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeeae
mlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcrq
ilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfakavigtpefm
apemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvaip
evkeiiegcirqnkderysikdllnhaffq

Timeline for d1t4ha_:

• d1t4ha_ first appeared in SCOP 1.69
  
• d1t4ha_ appears in SCOP 1.71
  
• d1t4ha_ last appears in SCOP 1.75