Lineage for d1t4ha_ (1t4h A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735403Protein Protein kinase wnk1 [111196] (1 species)
    OPK group; WNK subfamily; serine/threonine kinase
  7. 735404Species Human (Homo sapiens) [TaxId:9606] [111197] (1 PDB entry)
  8. 735405Domain d1t4ha_: 1t4h A: [106420]

Details for d1t4ha_

PDB Entry: 1t4h (more details), 1.8 Å

PDB Description: Crystal structure of the kinase domain of WNK1, a kinase that causes a hereditary form of hypertension
PDB Compounds: (A:) Serine/threonine-protein kinase WNK1

SCOP Domain Sequences for d1t4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}
avgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeeae
mlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcrq
ilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfakavigtpefm
apemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvaip
evkeiiegcirqnkderysikdllnhaffq

SCOP Domain Coordinates for d1t4ha_:

Click to download the PDB-style file with coordinates for d1t4ha_.
(The format of our PDB-style files is described here.)

Timeline for d1t4ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t4hb_