Lineage for d1t4ga2 (1t4g A:65-322)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112413Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)
  7. 2112424Species Methanococcus voltae [TaxId:2188] [110555] (14 PDB entries)
    Uniprot O73948
  8. 2112428Domain d1t4ga2: 1t4g A:65-322 [106419]
    Other proteins in same PDB: d1t4ga1
    complexed with anp, mg

Details for d1t4ga2

PDB Entry: 1t4g (more details), 2 Å

PDB Description: atpase in complex with amp-pnp
PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d1t4ga2:

Sequence, based on SEQRES records: (download)

>d1t4ga2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
adlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvaklydsp
hlpdaeaifritekgiqd

Sequence, based on observed residues (ATOM records): (download)

>d1t4ga2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
adlfncvvlvtnqvsghaatfrffvrkgkgdkrvaklydsphlpdaeaifritekgiqd

SCOPe Domain Coordinates for d1t4ga2:

Click to download the PDB-style file with coordinates for d1t4ga2.
(The format of our PDB-style files is described here.)

Timeline for d1t4ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t4ga1