![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.60: SAM domain-like [47768] (14 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein) |
![]() | Protein DNA repair protein Rad51, N-terminal domain [47796] (4 species) |
![]() | Species Archaeon Methanococcus voltae [TaxId:2188] [109872] (2 PDB entries) |
![]() | Domain d1t4ga1: 1t4g A:5-64 [106418] Other proteins in same PDB: d1t4ga2 complexed with anp, mg; mutant |
PDB Entry: 1t4g (more details), 2 Å
SCOP Domain Sequences for d1t4ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t4ga1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae} ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf
Timeline for d1t4ga1: