Lineage for d1t4dc1 (1t4d C:1-133,C:355-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843586Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 2843587Species Escherichia coli [TaxId:562] [51814] (4 PDB entries)
    Uniprot P00353
  8. 2843592Domain d1t4dc1: 1t4d C:1-133,C:355-367 [106416]
    Other proteins in same PDB: d1t4da2, d1t4db2, d1t4dc2

Details for d1t4dc1

PDB Entry: 1t4d (more details), 1.95 Å

PDB Description: crystal structure of escherichia coli aspartate beta-semialdehyde dehydrogenase (ecasadh), at 1.95 angstrom resolution
PDB Compounds: (C:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1t4dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4dc1 c.2.1.3 (C:1-133,C:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]}
mqnvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
dglnngirtfvggXaaeplrrmlrqla

SCOPe Domain Coordinates for d1t4dc1:

Click to download the PDB-style file with coordinates for d1t4dc1.
(The format of our PDB-style files is described here.)

Timeline for d1t4dc1: