Lineage for d1t4da2 (1t4d A:134-354)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1421944Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1421945Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1421946Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1421953Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 1421954Species Escherichia coli [TaxId:562] [55362] (4 PDB entries)
    Uniprot P00353
  8. 1421957Domain d1t4da2: 1t4d A:134-354 [106413]
    Other proteins in same PDB: d1t4da1, d1t4db1, d1t4dc1

Details for d1t4da2

PDB Entry: 1t4d (more details), 1.95 Å

PDB Description: crystal structure of escherichia coli aspartate beta-semialdehyde dehydrogenase (ecasadh), at 1.95 angstrom resolution
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1t4da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4da2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]}
nctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmghlyghvadelatp
ssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsreewkgqaetnkil
ntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndreitm
reltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwg

SCOPe Domain Coordinates for d1t4da2:

Click to download the PDB-style file with coordinates for d1t4da2.
(The format of our PDB-style files is described here.)

Timeline for d1t4da2: