![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [51814] (4 PDB entries) |
![]() | Domain d1t4da1: 1t4d A:1-133,A:355-367 [106412] Other proteins in same PDB: d1t4da2, d1t4db2, d1t4dc2 |
PDB Entry: 1t4d (more details), 1.95 Å
SCOP Domain Sequences for d1t4da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t4da1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} mqnvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit dglnngirtfvggXaaeplrrmlrqla
Timeline for d1t4da1:
![]() Domains from other chains: (mouse over for more information) d1t4db1, d1t4db2, d1t4dc1, d1t4dc2 |