SCOP 1.71: Domain d1t4da1: 1t4d A:1-133,A:355-367

Lineage for d1t4da1 (1t4d A:1-133,A:355-367)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Aspartate beta-semialdehyde dehydrogenase [51813] (3 species)

7. Species Escherichia coli [TaxId:562] [51814] (4 PDB entries)

8. Domain d1t4da1: 1t4d A:1-133,A:355-367 [106412]
   Other proteins in same PDB: d1t4da2, d1t4db2, d1t4dc2

Details for d1t4da1

PDB Entry: 1t4d, 1.95 Å

PDB Description: crystal structure of escherichia coli aspartate beta-semialdehyde dehydrogenase (ecasadh), at 1.95 angstrom resolution

SCOP Domain Sequences for d1t4da1:

Sequence; same for both SEQRES and ATOM records:

>d1t4da1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli}
mqnvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
dglnngirtfvggXaaeplrrmlrqla

Timeline for d1t4da1:

• d1t4da1 first appeared in SCOP 1.69
  
• d1t4da1 appears in SCOP 1.73
  
• d1t4da1 appears in the current release, SCOPe 2.08