Lineage for d1t47b2 (1t47 B:179-377)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942578Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2942605Species Streptomyces avermitilis [TaxId:33903] [110876] (1 PDB entry)
    Uniprot Q53586
  8. 2942609Domain d1t47b2: 1t47 B:179-377 [106401]
    complexed with fe2, ntd

Details for d1t47b2

PDB Entry: 1t47 (more details), 2.5 Å

PDB Description: Structure of fe2-HPPD bound to NTBC
PDB Compounds: (B:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d1t47b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t47b2 d.32.1.3 (B:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]}
hrtfqaidhcvgnvelgrmnewvgfynkvmgftnmkefvgddiateysalmskvvadgtl
kvkfpinepalakkksqideylefyggagvqhialntgdivetvrtmraagvqfldtpds
yydtlgewvgdtrvpvdtlrelkiladrdedgyllqiftkpvqdrptvffeiierhgsmg
fgkgnfkalfeaiereqek

SCOPe Domain Coordinates for d1t47b2:

Click to download the PDB-style file with coordinates for d1t47b2.
(The format of our PDB-style files is described here.)

Timeline for d1t47b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t47b1