Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species) |
Species Streptomyces avermitilis [TaxId:33903] [110876] (1 PDB entry) |
Domain d1t47b1: 1t47 B:16-178 [106400] |
PDB Entry: 1t47 (more details), 2.5 Å
SCOP Domain Sequences for d1t47b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t47b1 d.32.1.3 (B:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} dpfpvkgmdavvfavgnakqaahyystafgmqlvaysgpengsretasyvltngsarfvl tsvikpatpwghfladhvaehgdgvvdlaievpdaraahayaiehgarsvaepyelkdeh gtvvlaaiatygktrhtlvdrtgydgpylpgyvaaapiveppa
Timeline for d1t47b1: