![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
![]() | Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species) |
![]() | Species Streptomyces avermitilis [TaxId:33903] [110876] (1 PDB entry) Uniprot Q53586 |
![]() | Domain d1t47a2: 1t47 A:179-377 [106399] complexed with fe2, ntd |
PDB Entry: 1t47 (more details), 2.5 Å
SCOPe Domain Sequences for d1t47a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} hrtfqaidhcvgnvelgrmnewvgfynkvmgftnmkefvgddiateysalmskvvadgtl kvkfpinepalakkksqideylefyggagvqhialntgdivetvrtmraagvqfldtpds yydtlgewvgdtrvpvdtlrelkiladrdedgyllqiftkpvqdrptvffeiierhgsmg fgkgnfkalfeaiereqek
Timeline for d1t47a2: