Lineage for d1t47a1 (1t47 A:16-178)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720941Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 720942Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) (S)
  5. 721044Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 721080Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species)
  7. 721112Species Streptomyces avermitilis [TaxId:33903] [110876] (1 PDB entry)
  8. 721113Domain d1t47a1: 1t47 A:16-178 [106398]

Details for d1t47a1

PDB Entry: 1t47 (more details), 2.5 Å

PDB Description: Structure of fe2-HPPD bound to NTBC
PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOP Domain Sequences for d1t47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]}
dpfpvkgmdavvfavgnakqaahyystafgmqlvaysgpengsretasyvltngsarfvl
tsvikpatpwghfladhvaehgdgvvdlaievpdaraahayaiehgarsvaepyelkdeh
gtvvlaaiatygktrhtlvdrtgydgpylpgyvaaapiveppa

SCOP Domain Coordinates for d1t47a1:

Click to download the PDB-style file with coordinates for d1t47a1.
(The format of our PDB-style files is described here.)

Timeline for d1t47a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t47a2