Lineage for d1t46a_ (1t46 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542536Protein c-KIT receptor [103296] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2542537Species Human (Homo sapiens) [TaxId:9606] [103297] (5 PDB entries)
    Uniprot P10721 547-935
  8. 2542539Domain d1t46a_: 1t46 A: [106397]
    complexed with po4, sti

Details for d1t46a_

PDB Entry: 1t46 (more details), 1.6 Å

PDB Description: structural basis for the autoinhibition and sti-571 inhibition of c- kit tyrosine kinase
PDB Compounds: (A:) Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog

SCOPe Domain Sequences for d1t46a_:

Sequence, based on SEQRES records: (download)

>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]}
gnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkm
lkpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrr
krdsficsktspaimeddelaldledllsfsyqvakgmaflaskncihrdlaarnillth
gritkicdfglardikndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwel
fslgsspypgmpvdskfykmikegfrmlspehapaemydimktcwdadplkrptfkqivq
liekqisestn

Sequence, based on observed residues (ATOM records): (download)

>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]}
gnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkm
lkpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrr
krdsflaldledllsfsyqvakgmaflaskncihrdlaarnillthgritkicdfglard
ikndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwelfslgsspypgmpvd
skfykmikegfrmlspehapaemydimktcwdadplkrptfkqivqliekqisestn

SCOPe Domain Coordinates for d1t46a_:

Click to download the PDB-style file with coordinates for d1t46a_.
(The format of our PDB-style files is described here.)

Timeline for d1t46a_: