SCOPe 2.06: Domain d1t44a2: 1t44 A:147-375

Lineage for d1t44a2 (1t44 A:147-375)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (8 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (63 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d1t44a2: 1t44 A:147-375 [106394]
   Other proteins in same PDB: d1t44g_
   complexed with atp, ca

Details for d1t44a2

PDB Entry: 1t44, 2 Å

PDB Description: structural basis of actin sequestration by thymosin-b4: implications for arp2/3 activation

PDB Compounds: (A:) Actin, alpha

SCOPe Domain Sequences for d1t44a2:

Sequence; same for both SEQRES and ATOM records:

>d1t44a2 c.55.1.1 (A:147-375) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

Timeline for d1t44a2:

• d1t44a2 first appeared in SCOP 1.69
  
• d1t44a2 appears in SCOPe 2.05
  
• d1t44a2 appears in SCOPe 2.07
  
• d1t44a2 appears in the current release, SCOPe 2.08