Lineage for d1t43a_ (1t43 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893860Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (2 proteins)
  6. 2893861Protein N5-glutamine methyltransferase, HemK [89744] (2 species)
    contains an N-terminal alpha helical subdomain; res. 13-84
  7. 2893862Species Escherichia coli [TaxId:562] [110666] (2 PDB entries)
    Uniprot P37186
  8. 2893864Domain d1t43a_: 1t43 A: [106392]
    complexed with sah

Details for d1t43a_

PDB Entry: 1t43 (more details), 3.2 Å

PDB Description: Crystal Structure Analysis of E.coli Protein (N5)-Glutamine Methyltransferase (HemK)
PDB Compounds: (A:) Protein methyltransferase hemK

SCOPe Domain Sequences for d1t43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t43a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}
eyqhwlreaisqlqasesprrdaeillehvtgrgrtfilafgetqltdeqcqqldalltr
rrdgepiahltgvrefwslplfvspatliprpdteclveqalarlpeqpcrildlgtgtg
aialalaserpdceiiavdrmpdavslaqrnaqhlaiknihilqsdwfsalagqqfamiv
snppyideqdphlqqgdvrfepltalvaadsgmadivhiieqsrnalvsggflllehgwq
qgeavrqafilagyhdvetcrdygdnervtlgry

SCOPe Domain Coordinates for d1t43a_:

Click to download the PDB-style file with coordinates for d1t43a_.
(The format of our PDB-style files is described here.)

Timeline for d1t43a_: