SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1t43a_ (1t43 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130130Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (2 protein domains)
  6. 2130131Protein N5-glutamine methyltransferase, HemK [89744] (2 species)
    contains an N-terminal alpha helical subdomain; res. 13-84
  7. 2130132Species Escherichia coli [TaxId:562] [110666] (2 PDB entries)
    Uniprot P37186
  8. 2130134Domain d1t43a_: 1t43 A: [106392]
    complexed with sah

Details for d1t43a_

PDB Entry: 1t43 (more details), 3.2 Å

PDB Description: Crystal Structure Analysis of E.coli Protein (N5)-Glutamine Methyltransferase (HemK)
PDB Compounds: (A:) Protein methyltransferase hemK

SCOPe Domain Sequences for d1t43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t43a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}
eyqhwlreaisqlqasesprrdaeillehvtgrgrtfilafgetqltdeqcqqldalltr
rrdgepiahltgvrefwslplfvspatliprpdteclveqalarlpeqpcrildlgtgtg
aialalaserpdceiiavdrmpdavslaqrnaqhlaiknihilqsdwfsalagqqfamiv
snppyideqdphlqqgdvrfepltalvaadsgmadivhiieqsrnalvsggflllehgwq
qgeavrqafilagyhdvetcrdygdnervtlgry

SCOPe Domain Coordinates for d1t43a_:

Click to download the PDB-style file with coordinates for d1t43a_.
(The format of our PDB-style files is described here.)

Timeline for d1t43a_: