Lineage for d1t40a_ (1t40 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473932Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 473933Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 473964Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 473965Species Human (Homo sapiens) [TaxId:9606] [51437] (21 PDB entries)
  8. 473975Domain d1t40a_: 1t40 A: [106390]

Details for d1t40a_

PDB Entry: 1t40 (more details), 1.8 Å

PDB Description: crystal structure of human aldose reductase complexed with nadp and idd552 at ph 5

SCOP Domain Sequences for d1t40a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t40a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens)}
masrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk
effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
llsctshkdypfheef

SCOP Domain Coordinates for d1t40a_:

Click to download the PDB-style file with coordinates for d1t40a_.
(The format of our PDB-style files is described here.)

Timeline for d1t40a_: