Lineage for d1t3za_ (1t3z A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150853Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2150854Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2150855Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 protein domains)
    forms interlocked homodimer of two ring-like subunits
  6. 2150898Protein Formyl-CoA transferase [89798] (1 species)
  7. 2150899Species Oxalobacter formigenes [TaxId:847] [89799] (6 PDB entries)
    Uniprot O06644
  8. 2150906Domain d1t3za_: 1t3z A: [106388]
    complexed with cao; mutant

Details for d1t3za_

PDB Entry: 1t3z (more details), 2.3 Å

PDB Description: Formyl-CoA Tranferase mutant Asp169 to Ser
PDB Compounds: (A:) Formyl-coenzyme A transferase

SCOPe Domain Sequences for d1t3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3za_ c.123.1.1 (A:) Formyl-CoA transferase {Oxalobacter formigenes [TaxId: 847]}
tkpldginvldfthvqagpactqmmgflganvikierrgsgdmtrgwlqdkpnvdslyft
mfncnkrsieldmktpegkelleqmikkadvmvenfgpgaldrmgftweyiqelnprvil
asvkgyaeghanehlkvyenvaqcsggaaattgfwdgpptvsgaalgssnsgmhlmigil
aaleirhktgrgqkvavamqdavlnlvriklrdqqrlertgilaeypqaqpnfafdrdgn
plsfdnitsvprggnaggggqpgwmlkckgwetdadsyvyftiaanmwpqicdmidkpew
kddpayntfegrvdklmdifsfietkfadkdkfevtewaaqygipcgpvmsmkelahdps
lqkvgtvvevvdeirgnhltvgapfkfsgfqpeitrapllgehtdevlkelglddakike
lhakqvv

SCOPe Domain Coordinates for d1t3za_:

Click to download the PDB-style file with coordinates for d1t3za_.
(The format of our PDB-style files is described here.)

Timeline for d1t3za_: