Lineage for d1t3ta5 (1t3t A:617-816)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506461Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 506664Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) (S)
  5. 506665Family d.79.4.1: PurM N-terminal domain-like [55327] (3 proteins)
  6. 506672Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (1 species)
  7. 506673Species Salmonella typhimurium [TaxId:90371] [111036] (1 PDB entry)
  8. 506675Domain d1t3ta5: 1t3t A:617-816 [106385]
    Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta6, d1t3ta7

Details for d1t3ta5

PDB Entry: 1t3t (more details), 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase

SCOP Domain Sequences for d1t3ta5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ta5 d.79.4.1 (A:617-816) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium}
qtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqmvgpwqvp
vadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqigdikrikl
sanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegneqremts
plslvisafarvedvrhtlt

SCOP Domain Coordinates for d1t3ta5:

Click to download the PDB-style file with coordinates for d1t3ta5.
(The format of our PDB-style files is described here.)

Timeline for d1t3ta5: