Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.284: PurS-like [109622] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.284.1: PurS-like [82697] (2 families) segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit |
Family d.284.1.2: FGAM synthase PurL, PurS-like domain [111002] (1 protein) duplication: consists of 2 structural repeats of the PurS subunit fold, assembled like the PurS dimer |
Protein FGAM synthase PurL, PurS-like domain [111003] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [111004] (1 PDB entry) |
Domain d1t3ta3: 1t3t A:1-152 [106383] Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta4, d1t3ta5, d1t3ta6, d1t3ta7 complexed with adp, mg, so4 |
PDB Entry: 1t3t (more details), 1.9 Å
SCOP Domain Sequences for d1t3ta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ta3 d.284.1.2 (A:1-152) FGAM synthase PurL, PurS-like domain {Salmonella typhimurium [TaxId: 602]} mmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseqaqltrllq ygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvayyieastlt aeqwrqvaaelhdrmmetvfssltdaeklfih
Timeline for d1t3ta3: