Lineage for d1t3ta3 (1t3t A:1-152)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741366Fold d.284: PurS-like [109622] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 741367Superfamily d.284.1: PurS-like [82697] (2 families) (S)
    segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit
  5. 741385Family d.284.1.2: FGAM synthase PurL, PurS-like domain [111002] (1 protein)
    duplication: consists of 2 structural repeats of the PurS subunit fold, assembled like the PurS dimer
  6. 741386Protein FGAM synthase PurL, PurS-like domain [111003] (1 species)
  7. 741387Species Salmonella typhimurium [TaxId:90371] [111004] (1 PDB entry)
  8. 741388Domain d1t3ta3: 1t3t A:1-152 [106383]
    Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta4, d1t3ta5, d1t3ta6, d1t3ta7
    complexed with adp, mg, so4

Details for d1t3ta3

PDB Entry: 1t3t (more details), 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOP Domain Sequences for d1t3ta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ta3 d.284.1.2 (A:1-152) FGAM synthase PurL, PurS-like domain {Salmonella typhimurium [TaxId: 602]}
mmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseqaqltrllq
ygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvayyieastlt
aeqwrqvaaelhdrmmetvfssltdaeklfih

SCOP Domain Coordinates for d1t3ta3:

Click to download the PDB-style file with coordinates for d1t3ta3.
(The format of our PDB-style files is described here.)

Timeline for d1t3ta3: