SCOPe 2.07: Domain d1t3ta1: 1t3t A:153-220

Lineage for d1t3ta1 (1t3t A:153-220)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.10: FGAM synthase PurL, linker domain [109736] (1 family)

5. Family a.5.10.1: FGAM synthase PurL, linker domain [109737] (1 protein)

6. Protein FGAM synthase PurL, linker domain [109738] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [109739] (1 PDB entry)
   Uniprot P74881

8. Domain d1t3ta1: 1t3t A:153-220 [106381]
   Other proteins in same PDB: d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5, d1t3ta6, d1t3ta7, d1t3ta8
   complexed with adp, mg, so4

Details for d1t3ta1

PDB Entry: 1t3t, 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d1t3ta1:

Sequence; same for both SEQRES and ATOM records:

>d1t3ta1 a.5.10.1 (A:153-220) FGAM synthase PurL, linker domain {Salmonella typhimurium [TaxId: 90371]}
hqpapvssvdllgegrqalidanlrlglalaedeidylqeaftklgrnpndielymfaqa
nsehcrhk

Timeline for d1t3ta1:

• d1t3ta1 first appeared in SCOP 1.69
  
• d1t3ta1 appears in SCOPe 2.06
  
• d1t3ta1 appears in the current release, SCOPe 2.08