![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.10: FGAM synthase PurL, linker domain [109736] (1 family) ![]() |
![]() | Family a.5.10.1: FGAM synthase PurL, linker domain [109737] (1 protein) |
![]() | Protein FGAM synthase PurL, linker domain [109738] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [109739] (1 PDB entry) Uniprot P74881 |
![]() | Domain d1t3ta1: 1t3t A:153-220 [106381] Other proteins in same PDB: d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5, d1t3ta6, d1t3ta7 complexed with adp, mg, so4 |
PDB Entry: 1t3t (more details), 1.9 Å
SCOP Domain Sequences for d1t3ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ta1 a.5.10.1 (A:153-220) FGAM synthase PurL, linker domain {Salmonella typhimurium [TaxId: 90371]} hqpapvssvdllgegrqalidanlrlglalaedeidylqeaftklgrnpndielymfaqa nsehcrhk
Timeline for d1t3ta1: