SCOPe 2.08: Domain d1t3sa2: 1t3s A:218-415

Lineage for d1t3sa2 (1t3s A:218-415)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110528] (5 PDB entries)
   Uniprot P54288 234-451

8. Domain d1t3sa2: 1t3s A:218-415 [106380]
   Other proteins in same PDB: d1t3sa1
   complexed with hg

Details for d1t3sa2

PDB Entry: 1t3s, 2.3 Å

PDB Description: structural analysis of the voltage-dependent calcium channel beta subunit functional core

PDB Compounds: (A:) Dihydropyridine-sensitive L-type, calcium channel beta-2 subunit

SCOPe Domain Sequences for d1t3sa2:

Sequence, based on SEQRES records:

>d1t3sa2 c.37.1.1 (A:218-415) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislakrs
vlnnpskhaiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslap
ivvyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppelfdvildenqledace
hladyleaywkathppss

Sequence, based on observed residues (ATOM records):

>d1t3sa2 c.37.1.1 (A:218-415) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislakrs
vlnntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapivvyvkisspk
vlqrliksrgksqakhlnvqmvaadklaqcppelfdvildenqledacehladyleaywk
athppss

Timeline for d1t3sa2:

• d1t3sa2 first appeared in SCOP 1.69
  
• d1t3sa2 appears in SCOPe 2.07