Lineage for d1t3sa1 (1t3s A:35-141)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461236Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 461237Family b.34.2.1: SH3-domain [50045] (35 proteins)
  6. 461485Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 461486Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (4 PDB entries)
  8. 461490Domain d1t3sa1: 1t3s A:35-141 [106379]
    Other proteins in same PDB: d1t3sa2

Details for d1t3sa1

PDB Entry: 1t3s (more details), 2.3 Å

PDB Description: structural analysis of the voltage-dependent calcium channel beta subunit functional core

SCOP Domain Sequences for d1t3sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3sa1 b.34.2.1 (A:35-141) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus)}
eedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdfl
hvkekfnndwwigrlvkegceigfipsrvklenmrlqheqrakefkl

SCOP Domain Coordinates for d1t3sa1:

Click to download the PDB-style file with coordinates for d1t3sa1.
(The format of our PDB-style files is described here.)

Timeline for d1t3sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t3sa2