Lineage for d1t3qd2 (1t3q D:7-87)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499769Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 499862Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (11 proteins)
  6. 499918Protein Quinoline 2-oxidoreductase small subunit QorS, N-domain [110808] (1 species)
  7. 499919Species Pseudomonas putida [TaxId:303] [110809] (1 PDB entry)
  8. 499921Domain d1t3qd2: 1t3q D:7-87 [106374]
    Other proteins in same PDB: d1t3qa1, d1t3qb1, d1t3qb2, d1t3qc1, d1t3qc2, d1t3qd1, d1t3qe1, d1t3qe2, d1t3qf1, d1t3qf2

Details for d1t3qd2

PDB Entry: 1t3q (more details), 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86

SCOP Domain Sequences for d1t3qd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3qd2 d.15.4.2 (D:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida}
sqlmrisatingkprvfyveprmhladalrevvgltgtkigceqgvcgsctilidgapmr
scltlavqaegcsietvegls

SCOP Domain Coordinates for d1t3qd2:

Click to download the PDB-style file with coordinates for d1t3qd2.
(The format of our PDB-style files is described here.)

Timeline for d1t3qd2: