![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
![]() | Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) ![]() contains 2Fe-2S cluster |
![]() | Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins) |
![]() | Protein Quinoline 2-oxidoreductase small subunit QorS, C-domain [109849] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [109850] (1 PDB entry) Uniprot P72223 |
![]() | Domain d1t3qd1: 1t3q D:88-168 [106373] Other proteins in same PDB: d1t3qa2, d1t3qb1, d1t3qb2, d1t3qc1, d1t3qc2, d1t3qd2, d1t3qe1, d1t3qe2, d1t3qf1, d1t3qf2 complexed with fad, fes, gol, mcn, smo, so4 |
PDB Entry: 1t3q (more details), 1.8 Å
SCOPe Domain Sequences for d1t3qd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3qd1 a.56.1.1 (D:88-168) Quinoline 2-oxidoreductase small subunit QorS, C-domain {Pseudomonas putida [TaxId: 303]} qgeklnalqdsfrrhhalqcgfctagmlatarsilaenpapsrdevrevmsgnlcrctgy etiidaitdpavaeaarrgev
Timeline for d1t3qd1: