Lineage for d1t3qc2 (1t3q C:1-176)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2223741Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2223742Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2223838Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2223864Protein Quinoline 2-oxidoreductase medium subunit QorM [111209] (1 species)
  7. 2223865Species Pseudomonas putida [TaxId:303] [111210] (1 PDB entry)
    Uniprot P72222
  8. 2223866Domain d1t3qc2: 1t3q C:1-176 [106372]
    Other proteins in same PDB: d1t3qa1, d1t3qa2, d1t3qb1, d1t3qb2, d1t3qc1, d1t3qd1, d1t3qd2, d1t3qe1, d1t3qe2, d1t3qf1
    complexed with fad, fes, gol, mcn, smo, so4

Details for d1t3qc2

PDB Entry: 1t3q (more details), 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86
PDB Compounds: (C:) quinoline 2-oxidoreductase medium subunit

SCOPe Domain Sequences for d1t3qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3qc2 d.145.1.3 (C:1-176) Quinoline 2-oxidoreductase medium subunit QorM {Pseudomonas putida [TaxId: 303]}
mkfpafsyrapaslqeviqvladdpdariiaggqsllpllafrlvypsclvdlrnvself
eisqsagilsvgamvthfrnktdptvakcvpilpkvlahvahqavrnrgtlggslahada
gaempflmatlgatmyiassagvrsvsatdfmkghyftdleagevlvrveipipal

SCOPe Domain Coordinates for d1t3qc2:

Click to download the PDB-style file with coordinates for d1t3qc2.
(The format of our PDB-style files is described here.)

Timeline for d1t3qc2: