Lineage for d1t3qc2 (1t3q C:1-176)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512542Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 512543Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 512608Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (4 proteins)
  6. 512626Protein Quinoline 2-oxidoreductase medium subunit QorM [111209] (1 species)
  7. 512627Species Pseudomonas putida [TaxId:303] [111210] (1 PDB entry)
  8. 512628Domain d1t3qc2: 1t3q C:1-176 [106372]
    Other proteins in same PDB: d1t3qa1, d1t3qa2, d1t3qb1, d1t3qb2, d1t3qc1, d1t3qd1, d1t3qd2, d1t3qe1, d1t3qe2, d1t3qf1

Details for d1t3qc2

PDB Entry: 1t3q (more details), 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86

SCOP Domain Sequences for d1t3qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3qc2 d.145.1.3 (C:1-176) Quinoline 2-oxidoreductase medium subunit QorM {Pseudomonas putida}
mkfpafsyrapaslqeviqvladdpdariiaggqsllpllafrlvypsclvdlrnvself
eisqsagilsvgamvthfrnktdptvakcvpilpkvlahvahqavrnrgtlggslahada
gaempflmatlgatmyiassagvrsvsatdfmkghyftdleagevlvrveipipal

SCOP Domain Coordinates for d1t3qc2:

Click to download the PDB-style file with coordinates for d1t3qc2.
(The format of our PDB-style files is described here.)

Timeline for d1t3qc2: