Lineage for d1t3qc1 (1t3q C:177-285)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204289Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2204452Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2204453Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 2204479Protein Quinoline 2-oxidoreductase medium subunit QorM [111061] (1 species)
  7. 2204480Species Pseudomonas putida [TaxId:303] [111062] (1 PDB entry)
    Uniprot P72222
  8. 2204481Domain d1t3qc1: 1t3q C:177-285 [106371]
    Other proteins in same PDB: d1t3qa1, d1t3qa2, d1t3qb1, d1t3qb2, d1t3qc2, d1t3qd1, d1t3qd2, d1t3qe1, d1t3qe2, d1t3qf2
    complexed with fad, fes, gol, mcn, smo, so4

Details for d1t3qc1

PDB Entry: 1t3q (more details), 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86
PDB Compounds: (C:) quinoline 2-oxidoreductase medium subunit

SCOPe Domain Sequences for d1t3qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3qc1 d.87.2.1 (C:177-285) Quinoline 2-oxidoreductase medium subunit QorM {Pseudomonas putida [TaxId: 303]}
hwefdeyarrkgdyalvmaaaglsmqggrcvaarialgaveerahqairandflvgkvid
estaataaelategleprsdihgsrdlrlslakaitqrvilkaaqgamy

SCOPe Domain Coordinates for d1t3qc1:

Click to download the PDB-style file with coordinates for d1t3qc1.
(The format of our PDB-style files is described here.)

Timeline for d1t3qc1: