Lineage for d1t3qb1 (1t3q B:1-165)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502780Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 502781Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 502782Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (5 proteins)
  6. 502806Protein Quinoline 2-oxidoreductase large subunit QorL, N-domain [110905] (1 species)
  7. 502807Species Pseudomonas putida [TaxId:303] [110906] (1 PDB entry)
  8. 502808Domain d1t3qb1: 1t3q B:1-165 [106369]
    Other proteins in same PDB: d1t3qa1, d1t3qa2, d1t3qb2, d1t3qc1, d1t3qc2, d1t3qd1, d1t3qd2, d1t3qe2, d1t3qf1, d1t3qf2

Details for d1t3qb1

PDB Entry: 1t3q (more details), 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86

SCOP Domain Sequences for d1t3qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3qb1 d.41.1.1 (B:1-165) Quinoline 2-oxidoreductase large subunit QorL, N-domain {Pseudomonas putida}
mmkhevvalkkksigtsvlrredtrlltgrgryiadlvlsgmlhvaslrspfaharivsi
dvadaqalpgvelvwcgadvaelsqgivatmqvegfqttiqpllangvtrfvgeivavvv
assraiaedaaqliqveyeelpavtgieaalegearandtlagnv

SCOP Domain Coordinates for d1t3qb1:

Click to download the PDB-style file with coordinates for d1t3qb1.
(The format of our PDB-style files is described here.)

Timeline for d1t3qb1: