SCOPe 2.01: Domain d1t3qa2: 1t3q A:7-87

Lineage for d1t3qa2 (1t3q A:7-87)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)

6. Protein Quinoline 2-oxidoreductase small subunit QorS, N-domain [110808] (1 species)

7. Species Pseudomonas putida [TaxId:303] [110809] (1 PDB entry)
   Uniprot P72223

8. Domain d1t3qa2: 1t3q A:7-87 [106368]
   Other proteins in same PDB: d1t3qa1, d1t3qb1, d1t3qb2, d1t3qc1, d1t3qc2, d1t3qd1, d1t3qe1, d1t3qe2, d1t3qf1, d1t3qf2
   complexed with fad, fes, gol, mcn, smo, so4

Details for d1t3qa2

PDB Entry: 1t3q, 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86

PDB Compounds: (A:) quinoline 2-oxidoreductase small subunit

SCOPe Domain Sequences for d1t3qa2:

Sequence; same for both SEQRES and ATOM records:

>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]}
sqlmrisatingkprvfyveprmhladalrevvgltgtkigceqgvcgsctilidgapmr
scltlavqaegcsietvegls

Timeline for d1t3qa2:

• d1t3qa2 first appeared in SCOP 1.69
  
• d1t3qa2 appears in SCOP 1.75
  
• d1t3qa2 appears in SCOPe 2.02
  
• d1t3qa2 appears in the current release, SCOPe 2.08