SCOP 1.69: Domain d1t3nb2: 1t3n B:447-719

Lineage for d1t3nb2 (1t3n B:447-719)

1. Root: SCOP 1.69

2. Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein DNA polymerase iota [111295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111296] (1 PDB entry)

8. Domain d1t3nb2: 1t3n B:447-719 [106366]
   Other proteins in same PDB: d1t3na1, d1t3nb1

Details for d1t3nb2

PDB Entry: 1t3n, 2.3 Å

PDB Description: structure of the catalytic core of dna polymerase iota in complex with dna and dttp

SCOP Domain Sequences for d1t3nb2:

Sequence; same for both SEQRES and ATOM records:

>d1t3nb2 e.8.1.7 (B:447-719) DNA polymerase iota {Human (Homo sapiens)}
srvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdake
kcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqsd
elsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnklla
klvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfsp
kilekelgisvaqriqklsfgednspvilsgpp

Timeline for d1t3nb2:

• d1t3nb2 is new in SCOP 1.69
  
• d1t3nb2 appears in SCOP 1.71
  
• d1t3nb2 appears in the current release, SCOPe 2.08