Lineage for d1t3na2 (1t3n A:27-299)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884843Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 884932Protein DNA polymerase iota [111295] (1 species)
  7. 884933Species Human (Homo sapiens) [TaxId:9606] [111296] (8 PDB entries)
    Uniprot Q9UNA4
  8. 884936Domain d1t3na2: 1t3n A:27-299 [106364]
    Other proteins in same PDB: d1t3na1, d1t3nb1

Details for d1t3na2

PDB Entry: 1t3n (more details), 2.3 Å

PDB Description: structure of the catalytic core of dna polymerase iota in complex with dna and dttp
PDB Compounds: (A:) polymerase (DNA directed) iota

SCOP Domain Sequences for d1t3na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3na2 e.8.1.7 (A:27-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
srvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdake
kcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqsd
elsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnklla
klvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfsp
kilekelgisvaqriqklsfgednspvilsgpp

SCOP Domain Coordinates for d1t3na2:

Click to download the PDB-style file with coordinates for d1t3na2.
(The format of our PDB-style files is described here.)

Timeline for d1t3na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t3na1