Lineage for d1t3m.2 (1t3m C:,D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602052Family d.153.1.5: (Glycosyl)asparaginase [56261] (2 proteins)
    automatically mapped to Pfam PF01112
  6. 2602053Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (5 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 2602060Species Escherichia coli [TaxId:562] [103315] (3 PDB entries)
    Uniprot P37595
    isoaspartyl peptidase with L-asparaginase activity
    putative L-asparaginase YbiK
  8. 2602064Domain d1t3m.2: 1t3m C:,D: [106362]
    complexed with na, no3

Details for d1t3m.2

PDB Entry: 1t3m (more details), 1.65 Å

PDB Description: Structure of the isoaspartyl peptidase with L-asparaginase activity from E. coli
PDB Compounds: (C:) Putative L-asparaginase, (D:) Putative L-asparaginase

SCOPe Domain Sequences for d1t3m.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1t3m.2 d.153.1.5 (C:,D:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Escherichia coli [TaxId: 562]}
kaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrllee
cplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvmm
igegaenfafargmervspeifstslryeqllaarkXtvgavaldldgnlaaatstggmt
nklpgrvgdsplvgagcyannasvavsctgtgevfiralaaydiaalmdygglslaeace
rvvmeklpalggsggliaidhegnvalpfntegmyrawgyagdtpttgiyr

SCOPe Domain Coordinates for d1t3m.2:

Click to download the PDB-style file with coordinates for d1t3m.2.
(The format of our PDB-style files is described here.)

Timeline for d1t3m.2: