Lineage for d1t3m.2 (1t3m C:,D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 736442Family d.153.1.5: (Glycosyl)asparaginase [56261] (1 protein)
  6. 736443Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (3 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 736444Species Escherichia coli [TaxId:562] [103315] (3 PDB entries)
    isoaspartyl peptidase with L-asparaginase activity
    putative L-asparaginase YbiK
  8. 736448Domain d1t3m.2: 1t3m C:,D: [106362]
    complexed with na, no3

Details for d1t3m.2

PDB Entry: 1t3m (more details), 1.65 Å

PDB Description: Structure of the isoaspartyl peptidase with L-asparaginase activity from E. coli
PDB Compounds: (C:) Putative L-asparaginase, (D:) Putative L-asparaginase

SCOP Domain Sequences for d1t3m.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1t3m.2 d.153.1.5 (C:,D:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Escherichia coli [TaxId: 562]}
kaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrllee
cplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvmm
igegaenfafargmervspeifstslryeqllaarkXtvgavaldldgnlaaatstggmt
nklpgrvgdsplvgagcyannasvavsctgtgevfiralaaydiaalmdygglslaeace
rvvmeklpalggsggliaidhegnvalpfntegmyrawgyagdtpttgiyr

SCOP Domain Coordinates for d1t3m.2:

Click to download the PDB-style file with coordinates for d1t3m.2.
(The format of our PDB-style files is described here.)

Timeline for d1t3m.2: