![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110528] (4 PDB entries) |
![]() | Domain d1t3la2: 1t3l A:218-415 [106359] Other proteins in same PDB: d1t3la1, d1t3lb_ |
PDB Entry: 1t3l (more details), 2.2 Å
SCOP Domain Sequences for d1t3la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3la2 c.37.1.1 (A:218-415) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus)} tppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislakrs vlnnpskhaiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslap ivvyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppelfdvildenqledace hladyleaywkathppss
Timeline for d1t3la2: