SCOP 1.69: Domain d1t3la2: 1t3l A:218-415

Lineage for d1t3la2 (1t3l A:218-415)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110528] (4 PDB entries)

8. Domain d1t3la2: 1t3l A:218-415 [106359]
   Other proteins in same PDB: d1t3la1, d1t3lb_

Details for d1t3la2

PDB Entry: 1t3l, 2.2 Å

PDB Description: structural analysis of the voltage-dependent calcium channel beta subunit functional core in complex with alpha1 interaction domain

SCOP Domain Sequences for d1t3la2:

Sequence; same for both SEQRES and ATOM records:

>d1t3la2 c.37.1.1 (A:218-415) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus)}
tppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislakrs
vlnnpskhaiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslap
ivvyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppelfdvildenqledace
hladyleaywkathppss

Timeline for d1t3la2:

• d1t3la2 is new in SCOP 1.69
  
• d1t3la2 appears in SCOP 1.71
  
• d1t3la2 appears in the current release, SCOPe 2.08