Lineage for d1t3la2 (1t3l A:218-415)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866028Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)
  7. 2866038Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110528] (5 PDB entries)
    Uniprot P54288 234-451
  8. 2866039Domain d1t3la2: 1t3l A:218-415 [106359]
    Other proteins in same PDB: d1t3la1, d1t3lb_

Details for d1t3la2

PDB Entry: 1t3l (more details), 2.2 Å

PDB Description: structural analysis of the voltage-dependent calcium channel beta subunit functional core in complex with alpha1 interaction domain
PDB Compounds: (A:) Dihydropyridine-sensitive L-type, calcium channel beta-2 subunit

SCOPe Domain Sequences for d1t3la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3la2 c.37.1.1 (A:218-415) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislakrs
vlnnpskhaiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslap
ivvyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppelfdvildenqledace
hladyleaywkathppss

SCOPe Domain Coordinates for d1t3la2:

Click to download the PDB-style file with coordinates for d1t3la2.
(The format of our PDB-style files is described here.)

Timeline for d1t3la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t3la1
View in 3D
Domains from other chains:
(mouse over for more information)
d1t3lb_