Lineage for d1t3ia_ (1t3i A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131623Protein Probable cysteine desulfurase SufS [110684] (1 species)
  7. 2131624Species Synechocystis sp. PCC 6803 [TaxId:1148] [110685] (1 PDB entry)
    Uniprot Q55793 # slr0077
  8. 2131625Domain d1t3ia_: 1t3i A: [106354]
    complexed with 2os, gol, plp

Details for d1t3ia_

PDB Entry: 1t3i (more details), 1.8 Å

PDB Description: Structure of slr0077/SufS, the Essential Cysteine Desulfurase from Synechocystis PCC 6803
PDB Compounds: (A:) Probable cysteine desulfurase

SCOPe Domain Sequences for d1t3ia_:

Sequence, based on SEQRES records: (download)

>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]}
pslaatvrqdfpilnqeinghplvyldnaatsqkpravleklmhyyendnanvhrgahql
svratdayeavrnkvakfinarspreivytrnateainlvayswgmnnlkagdeiittvm
ehhsnlvpwqmvaaktgavlkfvqldeqesfdlehfktllsektklvtvvhisntlgcvn
paeeiaqlahqagakvlvdacqsaphypldvqlidcdwlvasghkmcaptgigflygkee
ileamppffgggemiaevffdhfttgelphkfeagtpaiaeaialgaavdyltdlgmeni
hnyevelthylwqglgqipqlrlygpnpkhgdraalasfnvaglhasdvatmvdqdgiai
rsghhctqplhrlfdasgsaraslyfyntkeeidlflqslqatirffs

Sequence, based on observed residues (ATOM records): (download)

>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]}
pslaatvrqdfpilnqeinghplvyldnaatsqkpravleklmhyyendnanvgahqlsv
ratdayeavrnkvakfinarspreivytrnateainlvayswgmnnlkagdeiittvmeh
hsnlvpwqmvaaktgavlkfvqldeqesfdlehfktllsektklvtvvhisntlgcvnpa
eeiaqlahqagakvlvdacqsaphypldvqlidcdwlvasghkmcaptgigflygkeeil
eamppffgggemiaevffdhfttgelphkfeagtpaiaeaialgaavdyltdlgmenihn
yevelthylwqglgqipqlrlygpnpkhgdraalasfnvaglhasdvatmvdqdgiairs
ghhctqplhrlfdasgsaraslyfyntkeeidlflqslqatirffs

SCOPe Domain Coordinates for d1t3ia_:

Click to download the PDB-style file with coordinates for d1t3ia_.
(The format of our PDB-style files is described here.)

Timeline for d1t3ia_: