Lineage for d1t3eb3 (1t3e B:499-653)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587735Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 587736Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 587781Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
  6. 587782Protein Gephyrin, domain 5 [110647] (1 species)
  7. 587783Species Rat (Rattus norvegicus) [TaxId:10116] [110648] (1 PDB entry)
  8. 587785Domain d1t3eb3: 1t3e B:499-653 [106353]
    Other proteins in same PDB: d1t3ea1, d1t3ea2, d1t3eb1, d1t3eb2
    complexed with so4

Details for d1t3eb3

PDB Entry: 1t3e (more details), 3.25 Å

PDB Description: Structural basis of dynamic glycine receptor clustering

SCOP Domain Sequences for d1t3eb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3eb3 c.57.1.2 (B:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus)}
pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
kiifalpgnpvsavvtcnlfvvpalrkmqgildpr

SCOP Domain Coordinates for d1t3eb3:

Click to download the PDB-style file with coordinates for d1t3eb3.
(The format of our PDB-style files is described here.)

Timeline for d1t3eb3: