SCOP 1.75: Domain d1t3eb2: 1t3e B:318-498

Lineage for d1t3eb2 (1t3e B:318-498)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)

6. Protein Gephyrin, domains 3 and 4 [110333] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110334] (3 PDB entries)
   Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))

8. Domain d1t3eb2: 1t3e B:318-498 [106352]
   Other proteins in same PDB: d1t3ea1, d1t3ea3, d1t3eb1, d1t3eb3
   complexed with so4

Details for d1t3eb2

PDB Entry: 1t3e, 3.25 Å

PDB Description: Structural basis of dynamic glycine receptor clustering

PDB Compounds: (B:) gephyrin

SCOP Domain Sequences for d1t3eb2:

Sequence, based on SEQRES records:

>d1t3eb2 b.103.1.1 (B:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
f

Sequence, based on observed residues (ATOM records):

>d1t3eb2 b.103.1.1 (B:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedtvrilvqa
rpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

Timeline for d1t3eb2:

• d1t3eb2 first appeared in SCOP 1.69
  
• d1t3eb2 appears in SCOP 1.73
  
• d1t3eb2 appears in SCOPe 2.01
  
• d1t3eb2 appears in the current release, SCOPe 2.08